PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA42G00001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 320aa    MW: 36478.6 Da    PI: 8.1423
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA42G00001genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.75.6e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l++ ++++G g+W+++++  g+ R++k+c++rw +yl
       AA42G00001 14 KGLWSPEEDEKLLNHITKHGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding48.81.6e-1567110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++++eE+ l+v++++ lG++ W+ Ia++++ gRt++++k+ w++
       AA42G00001  67 RGAFSPEEENLIVELHAVLGNR-WSQIAARLP-GRTDNEIKNLWNS 110
                      89********************.*********.*********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-27664IPR009057Homeodomain-like
PROSITE profilePS5129418.666961IPR017930Myb domain
SuperFamilySSF466891.01E-2912108IPR009057Homeodomain-like
SMARTSM007175.2E-131363IPR001005SANT/Myb domain
PfamPF002491.1E-151461IPR001005SANT/Myb domain
CDDcd001672.46E-111761No hitNo description
PROSITE profilePS5129425.74962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.5E-2665117IPR009057Homeodomain-like
SMARTSM007173.4E-1366114IPR001005SANT/Myb domain
PfamPF002492.6E-1467110IPR001005SANT/Myb domain
CDDcd001671.21E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0009733Biological Processresponse to auxin
GO:0010089Biological Processxylem development
GO:0010119Biological Processregulation of stomatal movement
GO:0010214Biological Processseed coat development
GO:0048364Biological Processroot development
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLNHIT KHGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SPEEENLIVE LHAVLGNRWS QIAARLPGRT DNEIKNLWNS CIKKKLKQRG  120
IDPNTHKPIS QKSPASTSSA TNQDFYTERL TSNSDFSDYF GFQKLNFNFT NTNNNLGDQF  180
NQLNMVNSIF QTPISLKPSD DDHVKLAAPN WELQSNNNAS SFFENGGSFS WLPSSSSSLI  240
KANNHNNSSS LEDVKWSEYM NTPFFNQNSQ PIYVKSEADF ISNNVITETW SQSQQETLET  300
GDVFPKDLQR MATISFDHSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00134DAPTransfer from AT1G09540Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006417564.11e-155hypothetical protein EUTSA_v10008000mg
TrEMBLV4L0S41e-155V4L0S4_EUTSA; Uncharacterized protein
STRINGscaffold_100991.11e-152(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.11e-139myb domain protein 61